Phylome Id: 226?q=blast
Blast Search

Enter an amino acid sequence


Example: TPDSQLIAEFVSITNSSTYLAEQYLSRNSNDLVEAVEDFYANNEPSQKSETKKSSSSNAKGSGVRTFRDLNDEDDD
EEDDKTNTNFFTGGEKSGLQVEDPNKDKDNDRSIIDQIFQKAREQMQQPDDRPSA